PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601595.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 933aa    MW: 103298 Da    PI: 5.3363
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601595.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.6e-28541592152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki ++
  XP_009601595.1 541 AEKHVSLNVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGIPRWPSRKIGKV 592
                     5899*********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995525612IPR003035RWP-RK domain
PfamPF020426.8E-25545592IPR003035RWP-RK domain
SuperFamilySSF542771.11E-20827916No hitNo description
PROSITE profilePS5174520.908832914IPR000270PB1 domain
SMARTSM006666.4E-22832914IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.4E-22833913No hitNo description
PfamPF005642.7E-17833913IPR000270PB1 domain
CDDcd064073.91E-31833913No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MEGIVSFDGG TMSSHIDETF NNAIEMMNFE AYAGWCTSPC AIEQMFASYP SFSPINPMPI  60
NYAPFEQLNF EQQFPCEGEN WMFQQNNDDQ LRDSSEEADY VSDTDNCIIP KSPCQSLPER  120
MLKALELFKE SSGGGILAQV WIPMKNGDDH YILSTCEQPF LFDQVLSGYR EVSRKFTFDV  180
DMKPGSFPGL PGRVFTSRIP EWTSNVQYYR EAEYLRVRYA VGHEVRGSIA LPVLEDDGHD  240
TPCCAVLELV TTKEKSNFDL EMGHVCRALQ SVNLRSTTPP RFSSQSLSKN QRTALAEIKD  300
VLRAVCHAHR LPLALTWIPR ICTGGCITSS DEKSVLCVEN TACYVSDKEM HGFLHACMGH  360
DLEEGQGIVG KSLQSNHPFF YPDVKEYHIS EYPLVHHARK FGLNAAVAIR LRSIFTGDDD  420
YILEFFLPVD MKGSTEQQLL LNNLSRTMQR ICKSLRTISD VELVGQGGAK CGLQSESVLD  480
LTPIDLSRKI SQHSLLGSTL DLSKATLDVC DSEIAGMEAD GSREQTMSVS RRQKEKKRRA  540
AEKHVSLNVL QQYFSGSLKD AAKSIGVCPT TLKRICRQHG IPRWPSRKIG KVNRSLVKIQ  600
TVLKSVQGIE GGLKFDPATG GLVAASSILQ DFDSEKSMLF PCKEVSVKNP DSQDAVSVLQ  660
TSCIDNHDSV VKMEEDTHVD GNQLAESNSP FSGFCHGCKL AALDAGSPAS QDKMQCTNSR  720
NVSLGSFCTK EGCRSCRLST SNLKLDNSGC HFISRFPHSM PDADDVEKKT RASNEMDGDD  780
VVMEHNKGSS SGMTDLSNVS GSMMNGSSSS SHSFGERKHT KVKASSEDGG SLITIKATYK  840
EDRIRFKFEP SAGCFQLYEE VAKRFKLQTG EFQLEYLDDE EEWVMLVNEE DLHECLEILD  900
SLGTHSVKFL VQDVSCAIGS SGSSTSCFLT SGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601595.10.0PREDICTED: protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM1A5B30.0M1A5B3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein